PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34092.3 Da    PI: 8.7118
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006848genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.1e-19140194256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Le+ F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  DCAR_006848 140 RKKLRLSKDQAAILEDSFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 194
                  788899***********************************************98 PP

2HD-ZIP_I/II128.92.1e-41140229191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LE+sF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev++Lr +l
  DCAR_006848 140 RKKLRLSKDQAAILEDSFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQDLR-AL 229
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.5E-265114IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.37E-18130197IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-18131190IPR009057Homeodomain-like
PROSITE profilePS5007117.394136196IPR001356Homeobox domain
SMARTSM003893.1E-16138200IPR001356Homeobox domain
CDDcd000861.10E-14140197No hitNo description
PfamPF000462.6E-16140194IPR001356Homeobox domain
PRINTSPR000313.1E-5167176IPR000047Helix-turn-helix motif
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5176192IPR000047Helix-turn-helix motif
SMARTSM003402.1E-26196239IPR003106Leucine zipper, homeobox-associated
PfamPF021832.0E-11196230IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMIHQREDHL GLTLSLNFQT GTHQPSLSSS PLQLNQTPSL ASSSTHSHFN LHNTTTLTKQ  60
TSDRSLFETC RVETRSFLKG IDVNRLPTMT VDMEEEAGVS SPNSTISSVS GKRRSLERSE  120
LGNNSDDLID CDDEDGDNSR KKLRLSKDQA AILEDSFKEH NTLNPKQKLA LAKRLGLRPR  180
QVEVWFQNRR ARTKLKQTEV DCEFLKRCCE NLTEENRRLQ KEVQDLRALK SSPQFYMQMA  240
PPTTLTMCPS CERVSAPVSS AASPSTTPVQ PLHSGSSHHR VPFNPWAIKP AAQQLLNATH  300
HRP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138144SRKKLRL
2188196RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX944491e-117X94449.1 P.brachycarpa mRNA for homeobox-leucine zipper protein (PHZ4).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-118PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466005e-93HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLQ407821e-137Q40782_PIMBR; Homeobox-leucine zipper protein
STRINGPOPTR_0003s07760.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-82homeobox protein 2